(data stored in ACNUC7421 zone)

EMBL: CP000386.PE497

CP000386.PE497       Location/Qualifiers
FT   CDS             538472..539575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0504"
FT                   /product="glucose sorbosone dehydrogenase"
FT                   /note="PFAM: glucose sorbosone dehydrogenase; KEGG:
FT                   cbu:CBU_0368 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03478"
FT                   /db_xref="GOA:Q1AYQ0"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR012938"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYQ0"
FT                   /protein_id="ABG03478.1"
FT                   /translation="MGPPSLLAPLALLLSFLLAVSCAGEAPPGGREGVGPLRVETVLSG
FT                   LDTPWEVVFAPDGRVFVTERPGRVLVVEDGELREEPYARLPVEEVGEGGQLGLALHPNF
FT                   RRNGVLYAYYTTREDGRLRNRLVRLVEEDGSARQEEVLLEGPAASIHDGGRVRVGPDGK
FT                   LYATLGDTADAGLAQDPRALAGKIIRLNLDGSVPRDNHFPGSPVYSYGHRNPQGLAWDE
FT                   AGNLYAPEHGQSAHDELNLVRPGRNYGWPVIEGGERREGMVAPILHSGEKTWAPSGAEY
FT                   VREGPWRGSILFTGLRGESLHRVEVDPEDPGRVVRHREYLEGEYGRLRTVVQGPDGALY
FT                   LLTSNRDGRGDPAPSDDRLLRVEVGGR"
     MGPPSLLAPL ALLLSFLLAV SCAGEAPPGG REGVGPLRVE TVLSGLDTPW EVVFAPDGRV        60
     FVTERPGRVL VVEDGELREE PYARLPVEEV GEGGQLGLAL HPNFRRNGVL YAYYTTREDG       120
     RLRNRLVRLV EEDGSARQEE VLLEGPAASI HDGGRVRVGP DGKLYATLGD TADAGLAQDP       180
     RALAGKIIRL NLDGSVPRDN HFPGSPVYSY GHRNPQGLAW DEAGNLYAPE HGQSAHDELN       240
     LVRPGRNYGW PVIEGGERRE GMVAPILHSG EKTWAPSGAE YVREGPWRGS ILFTGLRGES       300
     LHRVEVDPED PGRVVRHREY LEGEYGRLRT VVQGPDGALY LLTSNRDGRG DPAPSDDRLL       360
     RVEVGGR                                                                 367
//

If you have problems or comments...

PBIL Back to PBIL home page