(data stored in ACNUC7421 zone)

EMBL: CP000386.PE50

CP000386.PE50        Location/Qualifiers
FT   CDS             51418..52335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0050"
FT                   /product="6-phosphogluconate dehydrogenase
FT                   (decarboxylating)"
FT                   /EC_number="1.1.1.44"
FT                   /note="TIGRFAM: 6-phosphogluconate dehydrogenase related
FT                   protein; PFAM: 6-phosphogluconate dehydrogenase-like
FT                   6-phosphogluconate dehydrogenase, NAD-binding; KEGG:
FT                   dde:Dde_3470 6-phosphogluconate dehydrogenase related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03031"
FT                   /db_xref="GOA:Q1AZZ7"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR004849"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZZ7"
FT                   /protein_id="ABG03031.1"
FT                   /translation="MEIGIYGLGRMGANMVRRLLRSGEHRVVAGNRSPGPVDEAAKEGA
FT                   EGAYSMQELVDKLEPPRVIWSMVPAGEPTEKTLMGFAELAQEGDILIDGGNSYFRDSVR
FT                   RASALRERGLRFLDAGTSGGIWGLEVGYCLMVGGDRSAFEHVEPALKTLAPPDGYAYLG
FT                   EAGAGHFAKMVHNGVEYAMLQAYAEGFEILKKSPYGYDLRALSSLWNHGSVVRSWLLEL
FT                   AERAFEKDAELQSIRGYVEDSGEGRWTVLEAIEEDVPANAIAGALFARFASRQEDSFAM
FT                   KVIAALRREFGGHAVKEAGPGGGG"
     MEIGIYGLGR MGANMVRRLL RSGEHRVVAG NRSPGPVDEA AKEGAEGAYS MQELVDKLEP        60
     PRVIWSMVPA GEPTEKTLMG FAELAQEGDI LIDGGNSYFR DSVRRASALR ERGLRFLDAG       120
     TSGGIWGLEV GYCLMVGGDR SAFEHVEPAL KTLAPPDGYA YLGEAGAGHF AKMVHNGVEY       180
     AMLQAYAEGF EILKKSPYGY DLRALSSLWN HGSVVRSWLL ELAERAFEKD AELQSIRGYV       240
     EDSGEGRWTV LEAIEEDVPA NAIAGALFAR FASRQEDSFA MKVIAALRRE FGGHAVKEAG       300
     PGGGG                                                                   305
//

If you have problems or comments...

PBIL Back to PBIL home page