(data stored in ACNUC7421 zone)

EMBL: CP000386.PE500

CP000386.PE500       Location/Qualifiers
FT   CDS             541560..542912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0507"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rso:RS00896 probable transport transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03481"
FT                   /db_xref="GOA:Q1AYP7"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYP7"
FT                   /protein_id="ABG03481.1"
FT                   /translation="MRTAGGAKGGFATAEEDVGPGRRPARVFLGSGFMHGFLRGAPLAR
FT                   RDRLSFLVLLVSQFAATTGFMFVMPFMPLYVQQLGVEDPGRAAAWAGLLNTATAATMAL
FT                   AAPLWGRLADRFGPKPMLLRATFAGAAVVGVMGLAASPWHLLGLRLLQGTLTGTVAAAT
FT                   LLVAATAPAGRAGQRLGTLQTVIFAAAAAGPFLGGVFADLVGIRASFGVTSGLLALSAV
FT                   LILLGVDGARAPAEGAPRAQEGAGGGVPWLGLVPVLAALFVVQASNTGVAPALPGFVAG
FT                   LMEEPSGVASLAGQILGAGALAAALGSAAGGRLAERLGARTVIFCSLVLGGLAFLPQAA
FT                   VSSVAALWVLRVAASFFIGAVVPVANLAVRQAVPPDRQGRAFGVAASVTSVAFGVGPLG
FT                   GGLLASAFGFGAAFLVPGVLLLAAAGVLLLAPRSRARAVRILKAAAAHIIR"
     MRTAGGAKGG FATAEEDVGP GRRPARVFLG SGFMHGFLRG APLARRDRLS FLVLLVSQFA        60
     ATTGFMFVMP FMPLYVQQLG VEDPGRAAAW AGLLNTATAA TMALAAPLWG RLADRFGPKP       120
     MLLRATFAGA AVVGVMGLAA SPWHLLGLRL LQGTLTGTVA AATLLVAATA PAGRAGQRLG       180
     TLQTVIFAAA AAGPFLGGVF ADLVGIRASF GVTSGLLALS AVLILLGVDG ARAPAEGAPR       240
     AQEGAGGGVP WLGLVPVLAA LFVVQASNTG VAPALPGFVA GLMEEPSGVA SLAGQILGAG       300
     ALAAALGSAA GGRLAERLGA RTVIFCSLVL GGLAFLPQAA VSSVAALWVL RVAASFFIGA       360
     VVPVANLAVR QAVPPDRQGR AFGVAASVTS VAFGVGPLGG GLLASAFGFG AAFLVPGVLL       420
     LAAAGVLLLA PRSRARAVRI LKAAAAHIIR                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page