(data stored in ACNUC7421 zone)

EMBL: CP000386.PE503

CP000386.PE503       Location/Qualifiers
FT   CDS             544081..544680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0510"
FT                   /product="DNA replication and repair protein RecR"
FT                   /note="KEGG: lxx:Lxx03440 recombination protein RecR;
FT                   TIGRFAM: recombination protein RecR; PFAM: RecR protein
FT                   TOPRIM; SMART: Toprim subdomain"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03484"
FT                   /db_xref="GOA:Q1AYP4"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1AYP4"
FT                   /protein_id="ABG03484.1"
FT                   /translation="MATYARSVERLIAELSRLPTIGPRSAQRIAFHIIRTRKEEALALA
FT                   EALREVKERIRPCRRCFNLTEGEECDICRDPRRDRSVICVVEDPYDIGPIERTGEYRGL
FT                   YHVLGGALSPLDGVEPEDLRIAELVERVRSEGTRELILATNPNTTGEATAMFIAQEVRE
FT                   LPVRVTALASGLPVGGDLEYADEVTLGRAFAGRREL"
     MATYARSVER LIAELSRLPT IGPRSAQRIA FHIIRTRKEE ALALAEALRE VKERIRPCRR        60
     CFNLTEGEEC DICRDPRRDR SVICVVEDPY DIGPIERTGE YRGLYHVLGG ALSPLDGVEP       120
     EDLRIAELVE RVRSEGTREL ILATNPNTTG EATAMFIAQE VRELPVRVTA LASGLPVGGD       180
     LEYADEVTLG RAFAGRREL                                                    199
//

If you have problems or comments...

PBIL Back to PBIL home page