(data stored in ACNUC7421 zone)

EMBL: CP000386.PE505

CP000386.PE505       Location/Qualifiers
FT   CDS             546934..547398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0512"
FT                   /product="conserved hypothetical protein"
FT                   /note="TIGRFAM: conserved hypothetical protein; KEGG:
FT                   mka:MK1390 predicted Rossmann fold nucleotide-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03486"
FT                   /db_xref="InterPro:IPR005268"
FT                   /db_xref="InterPro:IPR041164"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYP2"
FT                   /protein_id="ABG03486.1"
FT                   /translation="MSGAPYISVVGSGRASGELYELAREVGRLVAGRGAVVVCGGLGGV
FT                   MEAAARGAREAGGVAIGVLPGEDRRGANRYLTYAVATGAGQARNLAVVCSGDAVIAVGG
FT                   EYGTLSEIGLARKVGRPVVVLRGWELGPHVAVAATPREAVERAFGMIGAL"
     MSGAPYISVV GSGRASGELY ELAREVGRLV AGRGAVVVCG GLGGVMEAAA RGAREAGGVA        60
     IGVLPGEDRR GANRYLTYAV ATGAGQARNL AVVCSGDAVI AVGGEYGTLS EIGLARKVGR       120
     PVVVLRGWEL GPHVAVAATP REAVERAFGM IGAL                                   154
//

If you have problems or comments...

PBIL Back to PBIL home page