(data stored in ACNUC7421 zone)

EMBL: CP000386.PE516

CP000386.PE516       Location/Qualifiers
FT   CDS             complement(553929..554606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0523"
FT                   /product="Camphor resistance CrcB protein"
FT                   /note="PFAM: Camphor resistance CrcB protein; KEGG:
FT                   hch:HCH_02448 integral membrane protein possibly involved
FT                   in chromosome condensation"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03497"
FT                   /db_xref="GOA:Q1AYN1"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1AYN1"
FT                   /protein_id="ABG03497.1"
FT                   /translation="MAQATVRLGSELQCERAVRLAHRRGVASATAYWGPETGSARHVFL
FT                   MLLDEEGKIEGVLPELRELLPDAGISVSREVVVHEAPRGFLEGEALRPRPFRAGLGHLG
FT                   WIFAGGALGAAARLAVEGAARRLAPAAYEAFPWGTLAANAAGSFLIAIFGTLIFERFVG
FT                   ERARAFWVLGFLGSLTTFSSYALHTLRGWEASPLLGGLYGGGSLLLGLLAALAGLRLTR
FT                   RLL"
     MAQATVRLGS ELQCERAVRL AHRRGVASAT AYWGPETGSA RHVFLMLLDE EGKIEGVLPE        60
     LRELLPDAGI SVSREVVVHE APRGFLEGEA LRPRPFRAGL GHLGWIFAGG ALGAAARLAV       120
     EGAARRLAPA AYEAFPWGTL AANAAGSFLI AIFGTLIFER FVGERARAFW VLGFLGSLTT       180
     FSSYALHTLR GWEASPLLGG LYGGGSLLLG LLAALAGLRL TRRLL                       225
//

If you have problems or comments...

PBIL Back to PBIL home page