(data stored in ACNUC7421 zone)

EMBL: CP000386.PE519

CP000386.PE519       Location/Qualifiers
FT   CDS             555947..556927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0526"
FT                   /product="D-amino acid oxidase"
FT                   /EC_number="1.4.3.3"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   sma:SAV1672 putative D-amino acid oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03500"
FT                   /db_xref="GOA:Q1AYM8"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR023209"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYM8"
FT                   /protein_id="ABG03500.1"
FT                   /translation="MCGMRGRVVARAVVVGCGVAGLSAAIALRERGFGVRVVAREPPER
FT                   TTSAVAAAVWYPYRAYPEERVLSWGARTFEVFRGLAADPRTGVRLGEGVELLRRSAPGE
FT                   PWWREAVSGFRRCREEELPPGCRGGYRFVAPVAEMPAYLAYLLDRLRGAGGTLELREVS
FT                   SLEEAGEGADVVVNCSGVWARELARDPSVFPIRGQILRVANPGLERFVLDEENPAGLTY
FT                   IVPRSGDCVLGGTAEEGRWSTEPDPATAEAILRRCSALEPRLRGARVLEHRAGLRPGRP
FT                   EVRLELEELPGGTPCVHNYGHGGSGVTLSWGCAEEAAALAGAALS"
     MCGMRGRVVA RAVVVGCGVA GLSAAIALRE RGFGVRVVAR EPPERTTSAV AAAVWYPYRA        60
     YPEERVLSWG ARTFEVFRGL AADPRTGVRL GEGVELLRRS APGEPWWREA VSGFRRCREE       120
     ELPPGCRGGY RFVAPVAEMP AYLAYLLDRL RGAGGTLELR EVSSLEEAGE GADVVVNCSG       180
     VWARELARDP SVFPIRGQIL RVANPGLERF VLDEENPAGL TYIVPRSGDC VLGGTAEEGR       240
     WSTEPDPATA EAILRRCSAL EPRLRGARVL EHRAGLRPGR PEVRLELEEL PGGTPCVHNY       300
     GHGGSGVTLS WGCAEEAAAL AGAALS                                            326
//

If you have problems or comments...

PBIL Back to PBIL home page