(data stored in ACNUC7421 zone)

EMBL: CP000386.PE520

CP000386.PE520       Location/Qualifiers
FT   CDS             557027..557785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0527"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH GntR-like; KEGG:
FT                   mta:Moth_2304 GntR-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03501"
FT                   /db_xref="GOA:Q1AYM7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYM7"
FT                   /protein_id="ABG03501.1"
FT                   /translation="MSTGGSGRERRLRPPRLSVGLAERLRGRILGGEFGPGERLPGNRE
FT                   LAAAYSVSVGSVREALQRLASEGLVEVRPGSGTYVSRDLRGSPWLPGGEQPLLDREQVE
FT                   ELIEAREVLEPRLAELAARRASAEQVEGLWRALERMQESVSDPSAFAEADVGFHMAVAE
FT                   ASGNRFLTRATADIRSLLRRDMELSAEVGIRRAGTLQFSVDSHRRLVAAIAAGDPEKAG
FT                   RIVSGILRRNRGFVIGLYSGGVSAEGSGEF"
     MSTGGSGRER RLRPPRLSVG LAERLRGRIL GGEFGPGERL PGNRELAAAY SVSVGSVREA        60
     LQRLASEGLV EVRPGSGTYV SRDLRGSPWL PGGEQPLLDR EQVEELIEAR EVLEPRLAEL       120
     AARRASAEQV EGLWRALERM QESVSDPSAF AEADVGFHMA VAEASGNRFL TRATADIRSL       180
     LRRDMELSAE VGIRRAGTLQ FSVDSHRRLV AAIAAGDPEK AGRIVSGILR RNRGFVIGLY       240
     SGGVSAEGSG EF                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page