(data stored in ACNUC7421 zone)

EMBL: CP000386.PE524

CP000386.PE524       Location/Qualifiers
FT   CDS             560781..561533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0531"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR Insect
FT                   alcohol dehydrogenase family; KEGG: sco:SCO0365 probable
FT                   oxidoreductase (secreted protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03505"
FT                   /db_xref="GOA:Q1AYM3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYM3"
FT                   /protein_id="ABG03505.1"
FT                   /translation="MAALDGKVAVVTGGGGGLGEGICAGLAAAGAAVAAVDVDLEKARR
FT                   VERLVAGRGGRCVAVEADVSSRRSVERMAERVAGELGGIDILVNNAAIYPLRPWTEIDE
FT                   EEWDRVLAVNIKGYFLCARAAYPYMRERGGGRIINVASITFFIGWAGFLDYVSSKGAVV
FT                   GFTRTLAREVGPEGITVNAVSPGAFPTDAERVHPDQEALNRRILDAQCIKRRGKPEDVG
FT                   NLVTFLASEEASFITGQTIEIDGGWAMH"
     MAALDGKVAV VTGGGGGLGE GICAGLAAAG AAVAAVDVDL EKARRVERLV AGRGGRCVAV        60
     EADVSSRRSV ERMAERVAGE LGGIDILVNN AAIYPLRPWT EIDEEEWDRV LAVNIKGYFL       120
     CARAAYPYMR ERGGGRIINV ASITFFIGWA GFLDYVSSKG AVVGFTRTLA REVGPEGITV       180
     NAVSPGAFPT DAERVHPDQE ALNRRILDAQ CIKRRGKPED VGNLVTFLAS EEASFITGQT       240
     IEIDGGWAMH                                                              250
//

If you have problems or comments...

PBIL Back to PBIL home page