(data stored in ACNUC7421 zone)

EMBL: CP000386.PE531

CP000386.PE531       Location/Qualifiers
FT   CDS             complement(567915..568403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0538"
FT                   /product="Cupin 2, conserved barrel"
FT                   /note="PFAM: Cupin 2, conserved barrel; KEGG:
FT                   reu:Reut_A0381 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03512"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR025979"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYL6"
FT                   /protein_id="ABG03512.1"
FT                   /translation="MAIDRGLRTFVEEMQLPDRAIDGEKIPWVPQGERVWFKPLRFDLA
FT                   GGRWINLLKVEGGGKVNRHRHTGGQVLGYCVEGSWRYLERDWVARPGTLVYEPPGDIHT
FT                   LVVDEESGGMVTLFILEGSVQYLDDEDNLIYQDDVFSKLRRYLDYCEQRGIEPEDLCY"
     MAIDRGLRTF VEEMQLPDRA IDGEKIPWVP QGERVWFKPL RFDLAGGRWI NLLKVEGGGK        60
     VNRHRHTGGQ VLGYCVEGSW RYLERDWVAR PGTLVYEPPG DIHTLVVDEE SGGMVTLFIL       120
     EGSVQYLDDE DNLIYQDDVF SKLRRYLDYC EQRGIEPEDL CY                          162
//

If you have problems or comments...

PBIL Back to PBIL home page