(data stored in ACNUC7421 zone)

EMBL: CP000386.PE539

CP000386.PE539       Location/Qualifiers
FT   CDS             575052..575945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0546"
FT                   /product="beta-lactamase-like protein"
FT                   /note="PFAM: beta-lactamase-like; KEGG: tfu:Tfu_2040
FT                   similar to Zn-dependent hydrolase including glyoxylases"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03520"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYK8"
FT                   /protein_id="ABG03520.1"
FT                   /translation="MEILPGIHRIESDLGPRFMCQYLLLGEERRVLVDTGIAKTPGEAI
FT                   APYLEGLGLGVGDLDEVIISHADLDHCGGNRALKRENPGLRISCGEPDRPYVERNRTML
FT                   AELYCWTEPYGFGPDEAAKERILEDLGGDCPVDAGLRGGETLRLGPGWRIEVLHLPGHT
FT                   PGHLGLWDARSGAAIIIDAALESGIYDREGNRLIPPRYFDAAAYERTLRSLLALRPRHL
FT                   LTAHYPPMGEREAEEFLRRSLEFVGRMRSLVRAALREGTTGLKELTARADAGLGPYPQS
FT                   AFELAAGVRAHLSELY"
     MEILPGIHRI ESDLGPRFMC QYLLLGEERR VLVDTGIAKT PGEAIAPYLE GLGLGVGDLD        60
     EVIISHADLD HCGGNRALKR ENPGLRISCG EPDRPYVERN RTMLAELYCW TEPYGFGPDE       120
     AAKERILEDL GGDCPVDAGL RGGETLRLGP GWRIEVLHLP GHTPGHLGLW DARSGAAIII       180
     DAALESGIYD REGNRLIPPR YFDAAAYERT LRSLLALRPR HLLTAHYPPM GEREAEEFLR       240
     RSLEFVGRMR SLVRAALREG TTGLKELTAR ADAGLGPYPQ SAFELAAGVR AHLSELY          297
//

If you have problems or comments...

PBIL Back to PBIL home page