(data stored in ACNUC7421 zone)

EMBL: CP000386.PE542

CP000386.PE542       Location/Qualifiers
FT   CDS             complement(577966..578970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0549"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   sai:Saci_2121 membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03523"
FT                   /db_xref="GOA:Q1AYK5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYK5"
FT                   /protein_id="ABG03523.1"
FT                   /translation="MAGQSATGGREGLLPRLSGALLERREAGIFAVAVALVVYFQAANA
FT                   AFLTQGNLRALAQFAATTAIIAVGLVMVMILGEIDLSVGQAYGFAPIVMYLAYERLLLV
FT                   LPLAIAVALAATAVVGFANGALRVYFGVPSFVATLGTFFLLGGLNVILTGGFPRPAPEE
FT                   SALKQALGAYPYAGILWATGIMIIMHAVLNHTRWGIHTFATGGNFTGAREAGIRVDRIR
FT                   IGNFMLCSVLGGFAGIIEAMRIDSIDPLVGGAEIMFYAIAAAVIGGTPLAGGVGTVIGA
FT                   FIGTLVISILRNGFTLQGVNANEFNIILGVAVLIVMALNIYVGRLRRGRRAPT"
     MAGQSATGGR EGLLPRLSGA LLERREAGIF AVAVALVVYF QAANAAFLTQ GNLRALAQFA        60
     ATTAIIAVGL VMVMILGEID LSVGQAYGFA PIVMYLAYER LLLVLPLAIA VALAATAVVG       120
     FANGALRVYF GVPSFVATLG TFFLLGGLNV ILTGGFPRPA PEESALKQAL GAYPYAGILW       180
     ATGIMIIMHA VLNHTRWGIH TFATGGNFTG AREAGIRVDR IRIGNFMLCS VLGGFAGIIE       240
     AMRIDSIDPL VGGAEIMFYA IAAAVIGGTP LAGGVGTVIG AFIGTLVISI LRNGFTLQGV       300
     NANEFNIILG VAVLIVMALN IYVGRLRRGR RAPT                                   334
//

If you have problems or comments...

PBIL Back to PBIL home page