(data stored in ACNUC7421 zone)

EMBL: CP000386.PE544

CP000386.PE544       Location/Qualifiers
FT   CDS             complement(580146..580925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0551"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   gka:GK1190 3-ketoacyl-(acyl-carrier-protein) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03525"
FT                   /db_xref="GOA:Q1AYK3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYK3"
FT                   /protein_id="ABG03525.1"
FT                   /translation="MYDLAGKRALVTGAGMGIGQAIAVELARCGADVAVHYAHTPPDET
FT                   VGEVERAGRRAHPVRGDLSRVPECERVVEEAAEALGGLDVLVNNAGITRALDFLDTDEE
FT                   TYDAIFDLNMKGYFFCARSAVPHMLEAGGGSIVNITSVHGFAGFPHHTAYAATKGAIIA
FT                   FTRQLAIELAGRGIRVNAIGPGLIEVPRYYDIPGYSPEQGRELVPWGRVGKPKDVGPAA
FT                   AFLASDAADFITGQVLYVDGGTTARMGLWWEQGEQPQ"
     MYDLAGKRAL VTGAGMGIGQ AIAVELARCG ADVAVHYAHT PPDETVGEVE RAGRRAHPVR        60
     GDLSRVPECE RVVEEAAEAL GGLDVLVNNA GITRALDFLD TDEETYDAIF DLNMKGYFFC       120
     ARSAVPHMLE AGGGSIVNIT SVHGFAGFPH HTAYAATKGA IIAFTRQLAI ELAGRGIRVN       180
     AIGPGLIEVP RYYDIPGYSP EQGRELVPWG RVGKPKDVGP AAAFLASDAA DFITGQVLYV       240
     DGGTTARMGL WWEQGEQPQ                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page