(data stored in ACNUC7421 zone)

EMBL: CP000386.PE545

CP000386.PE545       Location/Qualifiers
FT   CDS             complement(580929..582101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0552"
FT                   /product="Mandelate racemase/muconate lactonizing
FT                   enzyme-like protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   enzyme-like; KEGG: sco:SCO2401 dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03526"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYK2"
FT                   /protein_id="ABG03526.1"
FT                   /translation="MRISEVETFVVGTEWRNLTIVRLSTDEGLTGLGEARMVNHTEALL
FT                   GYIREAAGRHIIGHDPFRIEELVLKLTRDDFSRPGEVLSSGLACFEMACWDIVGKALGR
FT                   PVYDLLGGPVRERIKAYANGWYRVEREPEEFYAAARRVVERGYRALKVDPFGPGYYELE
FT                   REEKLRAVALVEAVREAVGPQTEILLEMHGRFSPAQALEMIRLLEPYGLGWAEEPVPPT
FT                   NLKALKKVSERVPAGIPVATGERIHQRGEYRELFELQAADVIQPDISHIGGLLETKKLA
FT                   AWADACYVTVAPHNVGGQIGTAAALHLAACTTNFRIQEYFNDFADPWLKRVAPGLPEVE
FT                   DGCFPLPRGPGLGVELDEEVVEAHPKQDVHFNLFAEGWEKREARRGRGAG"
     MRISEVETFV VGTEWRNLTI VRLSTDEGLT GLGEARMVNH TEALLGYIRE AAGRHIIGHD        60
     PFRIEELVLK LTRDDFSRPG EVLSSGLACF EMACWDIVGK ALGRPVYDLL GGPVRERIKA       120
     YANGWYRVER EPEEFYAAAR RVVERGYRAL KVDPFGPGYY ELEREEKLRA VALVEAVREA       180
     VGPQTEILLE MHGRFSPAQA LEMIRLLEPY GLGWAEEPVP PTNLKALKKV SERVPAGIPV       240
     ATGERIHQRG EYRELFELQA ADVIQPDISH IGGLLETKKL AAWADACYVT VAPHNVGGQI       300
     GTAAALHLAA CTTNFRIQEY FNDFADPWLK RVAPGLPEVE DGCFPLPRGP GLGVELDEEV       360
     VEAHPKQDVH FNLFAEGWEK REARRGRGAG                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page