(data stored in ACNUC7421 zone)

EMBL: CP000386.PE546

CP000386.PE546       Location/Qualifiers
FT   CDS             complement(582098..583033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0553"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK1960 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03527"
FT                   /db_xref="GOA:Q1AYK1"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYK1"
FT                   /protein_id="ABG03527.1"
FT                   /translation="MRARELLLGLGLPGGEPGEPPDSPKRFPDGAHYRVEIPSVEGPRV
FT                   LEAVLEEAERRGVHIHRVSQGSGIMLLTDAEIAEMCAMAREAGVELSLFVGPRASWETG
FT                   AAAISGAGRVLGAQHRGQDQLAYALEDVLRGVELGLRGVLVADAGLLWVLRDLKARGEL
FT                   PGDLVVKVSVQLAAANAAAVKAMESLGADTYNVPTDLSPAQLAAIRAVTSLPLDVYVEV
FT                   PDDFGGFVRHYEISEIVRAAAPVFVKFGLRNAPNIYPSGTHLEQTAVALGRERVRRAEI
FT                   GLSMLERYYPQAETTKPGTPFAGIPAREAA"
     MRARELLLGL GLPGGEPGEP PDSPKRFPDG AHYRVEIPSV EGPRVLEAVL EEAERRGVHI        60
     HRVSQGSGIM LLTDAEIAEM CAMAREAGVE LSLFVGPRAS WETGAAAISG AGRVLGAQHR       120
     GQDQLAYALE DVLRGVELGL RGVLVADAGL LWVLRDLKAR GELPGDLVVK VSVQLAAANA       180
     AAVKAMESLG ADTYNVPTDL SPAQLAAIRA VTSLPLDVYV EVPDDFGGFV RHYEISEIVR       240
     AAAPVFVKFG LRNAPNIYPS GTHLEQTAVA LGRERVRRAE IGLSMLERYY PQAETTKPGT       300
     PFAGIPAREA A                                                            311
//

If you have problems or comments...

PBIL Back to PBIL home page