(data stored in ACNUC7421 zone)

EMBL: CP000386.PE547

CP000386.PE547       Location/Qualifiers
FT   CDS             complement(583030..583788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0554"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH GntR-like; KEGG:
FT                   mta:Moth_1310 regulatory protein GntR, HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03528"
FT                   /db_xref="GOA:Q1AYK0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYK0"
FT                   /protein_id="ABG03528.1"
FT                   /translation="MTMCGGMGGATRRVRLRDRAAERLLEMILSGGLAVGERLPPEREL
FT                   VERLGVSRTVVREALNLLEARGVVSIEHGRGAVVSGGNPAAVQEALSALLRVRSRSLLE
FT                   LQEIRRILEVEVAGLAAERAGPEEVRAMREQLERMRAQIDAPEGYVDADVEFHAQLARA
FT                   TGNGVLLTMLEPVVELLRESRKVSASLPGAALRALEEHERILGCVERGDARGAREEMRA
FT                   HLEHTHRDIREALEEGLLADGRATRREEGR"
     MTMCGGMGGA TRRVRLRDRA AERLLEMILS GGLAVGERLP PERELVERLG VSRTVVREAL        60
     NLLEARGVVS IEHGRGAVVS GGNPAAVQEA LSALLRVRSR SLLELQEIRR ILEVEVAGLA       120
     AERAGPEEVR AMREQLERMR AQIDAPEGYV DADVEFHAQL ARATGNGVLL TMLEPVVELL       180
     RESRKVSASL PGAALRALEE HERILGCVER GDARGAREEM RAHLEHTHRD IREALEEGLL       240
     ADGRATRREE GR                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page