(data stored in ACNUC7421 zone)

EMBL: CP000386.PE549

CP000386.PE549       Location/Qualifiers
FT   CDS             complement(584262..584525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0556"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03530"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYJ8"
FT                   /protein_id="ABG03530.1"
FT                   /translation="MRRGRASPLSLGPAPSSLLQKRPVVEPLEEVCDLALGREPAEEAL
FT                   LEEPGALLLQGREHPASPPSGGSIFPGRPPGETSPTCSRAPL"
     MRRGRASPLS LGPAPSSLLQ KRPVVEPLEE VCDLALGREP AEEALLEEPG ALLLQGREHP        60
     ASPPSGGSIF PGRPPGETSP TCSRAPL                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page