(data stored in ACNUC7421 zone)

EMBL: CP000386.PE552

CP000386.PE552       Location/Qualifiers
FT   CDS             complement(585742..587685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0559"
FT                   /product="O-antigen polymerase"
FT                   /note="PFAM: TPR repeat O-antigen polymerase
FT                   Tetratricopeptide TPR_2; SMART: Tetratricopeptide region;
FT                   KEGG: mta:Moth_1253 O-antigen polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03533"
FT                   /db_xref="GOA:Q1AYJ5"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYJ5"
FT                   /protein_id="ABG03533.1"
FT                   /translation="MRKMEGLLKHARSRRLLPTLALAALALSAGWMGAWGAGYFVAVWG
FT                   PVALLLAALALALSLAGVPPGRGAARAALGLLAAYTLWTFASVLWAANKGDAWAGAGKT
FT                   AVYLLAFWVAAALVGAGASRRWALAASVLGPAAVAALTLPVLPESMGQMFHANRLLGTV
FT                   NYYNGEAALLLVPFWVAVYLGGSRQAHPLLRGAVLAGAALSAQLAVLTQSRGAMFAMAA
FT                   SLPVFFLLSGKRLRGLLALAAPAAAVSLSFPELNRVYLEFLNEGSPREALQAALPEVWL
FT                   LAAGAGLYGLAWGAADAVWSVDRRVVRAAGAVALAAALVGGAAGALAAVQRVGDPVAWA
FT                   GEKWEAFRTNDTAGQEQSRYLSVSGSGRYTLWRVAWEDFARRPVLGVGTHNYEATYYRL
FT                   REQAVGYVRQPHSLPLEVLAERGVVGGALLAGFLAVCVGAGLRERFGSLGGEGRAQVGA
FT                   LAAAVAYWFVHSSAEWFWQMPGVTLPAFLYLALLASPWRVARPSPLRWPLRAAAAAVAL
FT                   AAAAAVAPLYLADRAEAQSHGLRDPREALAAVERAQSLNPWDPRLREREAELAMQAGQW
FT                   ERAERAYREAIELNPRHFAPYMRLATYYERRGRLEDALRSYREALRRNPLDEELQRKVG
FT                   WLASSAGRERQE"
     MRKMEGLLKH ARSRRLLPTL ALAALALSAG WMGAWGAGYF VAVWGPVALL LAALALALSL        60
     AGVPPGRGAA RAALGLLAAY TLWTFASVLW AANKGDAWAG AGKTAVYLLA FWVAAALVGA       120
     GASRRWALAA SVLGPAAVAA LTLPVLPESM GQMFHANRLL GTVNYYNGEA ALLLVPFWVA       180
     VYLGGSRQAH PLLRGAVLAG AALSAQLAVL TQSRGAMFAM AASLPVFFLL SGKRLRGLLA       240
     LAAPAAAVSL SFPELNRVYL EFLNEGSPRE ALQAALPEVW LLAAGAGLYG LAWGAADAVW       300
     SVDRRVVRAA GAVALAAALV GGAAGALAAV QRVGDPVAWA GEKWEAFRTN DTAGQEQSRY       360
     LSVSGSGRYT LWRVAWEDFA RRPVLGVGTH NYEATYYRLR EQAVGYVRQP HSLPLEVLAE       420
     RGVVGGALLA GFLAVCVGAG LRERFGSLGG EGRAQVGALA AAVAYWFVHS SAEWFWQMPG       480
     VTLPAFLYLA LLASPWRVAR PSPLRWPLRA AAAAVALAAA AAVAPLYLAD RAEAQSHGLR       540
     DPREALAAVE RAQSLNPWDP RLREREAELA MQAGQWERAE RAYREAIELN PRHFAPYMRL       600
     ATYYERRGRL EDALRSYREA LRRNPLDEEL QRKVGWLASS AGRERQE                     647
//

If you have problems or comments...

PBIL Back to PBIL home page