(data stored in ACNUC7421 zone)

EMBL: CP000386.PE553

CP000386.PE553       Location/Qualifiers
FT   CDS             587827..589305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0560"
FT                   /product="Protein-tyrosine kinase"
FT                   /EC_number="2.7.10.1"
FT                   /note="PFAM: lipopolysaccharide biosynthesis; KEGG:
FT                   fra:Francci3_3472 protein-tyrosine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03534"
FT                   /db_xref="GOA:Q1AYJ4"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR005702"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYJ4"
FT                   /protein_id="ABG03534.1"
FT                   /translation="MRDENHLRQRRSTNGPEAGPPPDDEIVISLDELLRVLWRRAWIIA
FT                   LVAGLLTAAAAGFSLLRTPIYEASIQIVIGQREGAAPTNLGSDVMGLQQLTRTMAEVLE
FT                   SRTVANAVIREMNLPTDAETFLENMTVEPVTETQVIEVSYRDPDPERAQQVANTIGRVF
FT                   SEQVSDLSPSANAVTATVWERAQLPDEPVSPQPLRNAAMALVLGLMLGTGAAFLVEHLD
FT                   DRWRSPEDAEQVSGVPTFGVVRQFDTSGGKRRRGRLLRRRGDKKEDMLDLAGRLVTLVD
FT                   QDGLAAEDYRSLRTNLFYAFVDAPPRAIVTTSPGPREGKSTTCANLGVALAQAGRSTLL
FT                   LDCDLRKPVVHEIFGLRNIRGVVDVLAGTRELREVWHSPVPNLRVVPTGPIPPNPAELL
FT                   SSRRFQQMLEEARGQFDYVLMDAPPVEAVSDPVILATHSDGVLLVIDAQNTRKGAVRRA
FT                   MRSLEAVGARVLGTVLNNAGETEGGYYYYRRYGY"
     MRDENHLRQR RSTNGPEAGP PPDDEIVISL DELLRVLWRR AWIIALVAGL LTAAAAGFSL        60
     LRTPIYEASI QIVIGQREGA APTNLGSDVM GLQQLTRTMA EVLESRTVAN AVIREMNLPT       120
     DAETFLENMT VEPVTETQVI EVSYRDPDPE RAQQVANTIG RVFSEQVSDL SPSANAVTAT       180
     VWERAQLPDE PVSPQPLRNA AMALVLGLML GTGAAFLVEH LDDRWRSPED AEQVSGVPTF       240
     GVVRQFDTSG GKRRRGRLLR RRGDKKEDML DLAGRLVTLV DQDGLAAEDY RSLRTNLFYA       300
     FVDAPPRAIV TTSPGPREGK STTCANLGVA LAQAGRSTLL LDCDLRKPVV HEIFGLRNIR       360
     GVVDVLAGTR ELREVWHSPV PNLRVVPTGP IPPNPAELLS SRRFQQMLEE ARGQFDYVLM       420
     DAPPVEAVSD PVILATHSDG VLLVIDAQNT RKGAVRRAMR SLEAVGARVL GTVLNNAGET       480
     EGGYYYYRRY GY                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page