(data stored in ACNUC7421 zone)

EMBL: CP000386.PE554

CP000386.PE554       Location/Qualifiers
FT   CDS             589575..590945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0561"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: polysaccharide biosynthesis protein; KEGG:
FT                   noc:Noc_1513 polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03535"
FT                   /db_xref="GOA:Q1AYJ3"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYJ3"
FT                   /protein_id="ABG03535.1"
FT                   /translation="MMGLSSSMFDKYVLLSLKRRLFSGGAWAFAGRVGTMFFGLASNAL
FT                   LARLLSPQDLGTYFLAFSVASFGAMAGSLGLNQAAVRLIAESLGTGQFGRTRRVVGAVI
FT                   VLGVLGILIIGCLYLLLLGRFLGTDLFDAPSLVAITWLVAGWMAVLTWQEILSGVFRGF
FT                   HDIRWATVFGGLMTSVLLATSLLLLWLFQEESTLATVVLLAIVSGGASALLGGWLLRLK
FT                   VTSIPLEGALNQRAFKTVAGVAWPLLITNLTLFALMQVDLWILGAFRSQEEVAIYGAAA
FT                   RLAALVVAPLAVVNAVVPPLIAEMYAQGRRGELERMLRFTAALAAAPALLTVLGFTILG
FT                   VPILTLVYGGYYREGTVVLALLSLGQMASVLTGSCALTLMMTGHQVTSMIITVAAGVLM
FT                   IIVALQVVDPYGATGVAVATCGGLVFQNVVMWLMAKRKTGIWTHFSFSVLRSIRGFS"
     MMGLSSSMFD KYVLLSLKRR LFSGGAWAFA GRVGTMFFGL ASNALLARLL SPQDLGTYFL        60
     AFSVASFGAM AGSLGLNQAA VRLIAESLGT GQFGRTRRVV GAVIVLGVLG ILIIGCLYLL       120
     LLGRFLGTDL FDAPSLVAIT WLVAGWMAVL TWQEILSGVF RGFHDIRWAT VFGGLMTSVL       180
     LATSLLLLWL FQEESTLATV VLLAIVSGGA SALLGGWLLR LKVTSIPLEG ALNQRAFKTV       240
     AGVAWPLLIT NLTLFALMQV DLWILGAFRS QEEVAIYGAA ARLAALVVAP LAVVNAVVPP       300
     LIAEMYAQGR RGELERMLRF TAALAAAPAL LTVLGFTILG VPILTLVYGG YYREGTVVLA       360
     LLSLGQMASV LTGSCALTLM MTGHQVTSMI ITVAAGVLMI IVALQVVDPY GATGVAVATC       420
     GGLVFQNVVM WLMAKRKTGI WTHFSFSVLR SIRGFS                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page