(data stored in ACNUC7421 zone)

EMBL: CP000386.PE559

CP000386.PE559       Location/Qualifiers
FT   CDS             595213..596298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0566"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1; KEGG:
FT                   tcx:Tcr_1682 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03540"
FT                   /db_xref="GOA:Q1AYI8"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYI8"
FT                   /protein_id="ABG03540.1"
FT                   /translation="MVKVLMISGSLPPRVCGVGDNAFRLAAALSEAGMNVEILTTTGPV
FT                   PDDSLGVDIHASVRNWNLLRLSEAMREIRAIRPDIVHLQYPTAEYKAGLLPQALVLSRV
FT                   PLVVTIHEASYVHILRRISLYPFLILADRVVATTRFEADFLVGLYPSVRKKLSVVSIGS
FT                   SIPAGPVLVRDRNTIMYFGLIAPRKGIEEFLELADLAGEAGKPWTFRIVGALSSRWREY
FT                   AQELHKDALSLSVEWHLNLSAEEVAKHLASVGAVYLPFPDGASLRRSSLIAALVNSSPI
FT                   ITTRGGSTPSDLVDGENVLFANSPEVALKKIQRLVSDAELSRRLSCGAAEYGKRFSWSQ
FT                   IAEQYIDLYGYVLSTRKRGRP"
     MVKVLMISGS LPPRVCGVGD NAFRLAAALS EAGMNVEILT TTGPVPDDSL GVDIHASVRN        60
     WNLLRLSEAM REIRAIRPDI VHLQYPTAEY KAGLLPQALV LSRVPLVVTI HEASYVHILR       120
     RISLYPFLIL ADRVVATTRF EADFLVGLYP SVRKKLSVVS IGSSIPAGPV LVRDRNTIMY       180
     FGLIAPRKGI EEFLELADLA GEAGKPWTFR IVGALSSRWR EYAQELHKDA LSLSVEWHLN       240
     LSAEEVAKHL ASVGAVYLPF PDGASLRRSS LIAALVNSSP IITTRGGSTP SDLVDGENVL       300
     FANSPEVALK KIQRLVSDAE LSRRLSCGAA EYGKRFSWSQ IAEQYIDLYG YVLSTRKRGR       360
     P                                                                       361
//

If you have problems or comments...

PBIL Back to PBIL home page