(data stored in ACNUC7421 zone)

EMBL: CP000386.PE565

CP000386.PE565       Location/Qualifiers
FT   CDS             603080..603967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0574"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="PFAM: helix-turn-helix protein RpiR; KEGG:
FT                   sco:SCO0724 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03546"
FT                   /db_xref="GOA:Q1AYI2"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYI2"
FT                   /protein_id="ABG03546.1"
FT                   /translation="MAEREDGERRAGVADGRVRALLQRLFDGSRLSPTQRRLARYVMDH
FT                   PDEALFLSSVELARRVGVSQPSVTRLAVAMGYGGYGELQRELRAVALEGGGGGAGSEAP
FT                   NKFQGAVRAEIENLRALERSLEDTGAVEELGRELAASEPLCVLGLRVSAPLAGYFGYFA
FT                   KKIHPDVRVLTEGGSAAFDALAQARAAGGAWVLCFLLPRHPRETLQAMSYARSLGLRVA
FT                   TVADRETGWIRELSDAVLPAEVGTRLVFDSQAAAMVLAGVLLEALSDAAPKRAQERLEE
FT                   FEQRAARLGFFETG"
     MAEREDGERR AGVADGRVRA LLQRLFDGSR LSPTQRRLAR YVMDHPDEAL FLSSVELARR        60
     VGVSQPSVTR LAVAMGYGGY GELQRELRAV ALEGGGGGAG SEAPNKFQGA VRAEIENLRA       120
     LERSLEDTGA VEELGRELAA SEPLCVLGLR VSAPLAGYFG YFAKKIHPDV RVLTEGGSAA       180
     FDALAQARAA GGAWVLCFLL PRHPRETLQA MSYARSLGLR VATVADRETG WIRELSDAVL       240
     PAEVGTRLVF DSQAAAMVLA GVLLEALSDA APKRAQERLE EFEQRAARLG FFETG            295
//

If you have problems or comments...

PBIL Back to PBIL home page