(data stored in ACNUC7421 zone)

EMBL: CP000386.PE568

CP000386.PE568       Location/Qualifiers
FT   CDS             607231..608235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0577"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: ATPase; KEGG:
FT                   sco:SCO2931 putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03549"
FT                   /db_xref="GOA:Q1AYH9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005892"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYH9"
FT                   /protein_id="ABG03549.1"
FT                   /translation="MPRSSCQGCISERTGDAMIEFRGVTKTYPGSERPAVENLSFEVPE
FT                   GEICVLVGPSGCGKTTTMRMINRLIEPTEGEILIGGEPNTRISGTELRRKIGYAIQQIG
FT                   LFPHRTIAENVGTVPSLLEWDRERIRRRVDELLELVGLDPAGFRDRYPAELSGGQQQRV
FT                   GVARALAADPPIMLMDEPFGAVDPITRERLQDEFLKIQQDIKKTIVFVTHDIDEAIKLG
FT                   DRIAILKEGGTLAQYDSPENILTSPASEFVASFVGADRVLKRLSLTRLEEVELDPPRGN
FT                   GGLPRLPEQASLKDALSEMIGSGAERVLVLSGDGGVRGSLSLDGLRRLSGRAG"
     MPRSSCQGCI SERTGDAMIE FRGVTKTYPG SERPAVENLS FEVPEGEICV LVGPSGCGKT        60
     TTMRMINRLI EPTEGEILIG GEPNTRISGT ELRRKIGYAI QQIGLFPHRT IAENVGTVPS       120
     LLEWDRERIR RRVDELLELV GLDPAGFRDR YPAELSGGQQ QRVGVARALA ADPPIMLMDE       180
     PFGAVDPITR ERLQDEFLKI QQDIKKTIVF VTHDIDEAIK LGDRIAILKE GGTLAQYDSP       240
     ENILTSPASE FVASFVGADR VLKRLSLTRL EEVELDPPRG NGGLPRLPEQ ASLKDALSEM       300
     IGSGAERVLV LSGDGGVRGS LSLDGLRRLS GRAG                                   334
//

If you have problems or comments...

PBIL Back to PBIL home page