(data stored in ACNUC7421 zone)

EMBL: CP000386.PE569

CP000386.PE569       Location/Qualifiers
FT   CDS             608239..608946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0578"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ava:Ava_2960
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03550"
FT                   /db_xref="GOA:Q1AYH8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYH8"
FT                   /protein_id="ABG03550.1"
FT                   /translation="MEPAPASLALLQRLEPRIMDWAWVRENFAEDILPALVGHIYLSGV
FT                   SLAIALAVSLPTGVLVARYRKAYPPVVFLAGLLFTIPSLALFAILVTIPGVGIGPNAVI
FT                   IALVAYSILVLVRNTVAGLDSVPPETIDAARGMGLTPRQILFKVELPLALPVIVAGVRI
FT                   ATVTVIGIATIGAYIAGGGLGQLIFDGIDRLFPTMIIAGAALATALAVAADVVLSSLER
FT                   YLRPWAQRGKRAA"
     MEPAPASLAL LQRLEPRIMD WAWVRENFAE DILPALVGHI YLSGVSLAIA LAVSLPTGVL        60
     VARYRKAYPP VVFLAGLLFT IPSLALFAIL VTIPGVGIGP NAVIIALVAY SILVLVRNTV       120
     AGLDSVPPET IDAARGMGLT PRQILFKVEL PLALPVIVAG VRIATVTVIG IATIGAYIAG       180
     GGLGQLIFDG IDRLFPTMII AGAALATALA VAADVVLSSL ERYLRPWAQR GKRAA            235
//

If you have problems or comments...

PBIL Back to PBIL home page