(data stored in ACNUC7421 zone)

EMBL: CP000386.PE573

CP000386.PE573       Location/Qualifiers
FT   CDS             612077..613294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0582"
FT                   /product="Amidase, hydantoinase/carbamoylase"
FT                   /EC_number="3.5.1.87"
FT                   /note="KEGG: gka:GK3252 N-carbamoyl-L-amino acid
FT                   amidohydrolase; TIGRFAM: Amidase,
FT                   hydantoinase/carbamoylase; PFAM: peptidase M20"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03554"
FT                   /db_xref="GOA:Q1AYH4"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYH4"
FT                   /protein_id="ABG03554.1"
FT                   /translation="MDIKRVRERLEELFALAPDPRGGATRLAYSPEEARAMRLVAGWLE
FT                   EAGLSARLDRFGNLWGLPPAGGRLVTGGSHVDTVPNGGRLDGALGTVLAVEAAGELEGP
FT                   FGVLVCAGEEAPRFGAGTLGSRQLAGRLGEAELARMRDRDGVSALAAREEFLRLLRDIP
FT                   RLEEPDPLSRVAAHLEVHVEQRRWLGERGASVGIATAVAGPERYRLLLSGQSGHSGEAR
FT                   MPERRDALCAAAEVILLVEGAARKASSTVATVGTVRVEPGSLTAVPGRVELGLDVRGTD
FT                   PGEAGELVRLVLERGRGICARRGVSFSARRLSRAAPVALDEGVVGLAERVARREGIPAA
FT                   RCVSFAGHDVQHLARRVPAALLFAASSNGVSHAPGEEVGEEDLERTYRMARALMPELAR
FT                   EYGGER"
     MDIKRVRERL EELFALAPDP RGGATRLAYS PEEARAMRLV AGWLEEAGLS ARLDRFGNLW        60
     GLPPAGGRLV TGGSHVDTVP NGGRLDGALG TVLAVEAAGE LEGPFGVLVC AGEEAPRFGA       120
     GTLGSRQLAG RLGEAELARM RDRDGVSALA AREEFLRLLR DIPRLEEPDP LSRVAAHLEV       180
     HVEQRRWLGE RGASVGIATA VAGPERYRLL LSGQSGHSGE ARMPERRDAL CAAAEVILLV       240
     EGAARKASST VATVGTVRVE PGSLTAVPGR VELGLDVRGT DPGEAGELVR LVLERGRGIC       300
     ARRGVSFSAR RLSRAAPVAL DEGVVGLAER VARREGIPAA RCVSFAGHDV QHLARRVPAA       360
     LLFAASSNGV SHAPGEEVGE EDLERTYRMA RALMPELARE YGGER                       405
//

If you have problems or comments...

PBIL Back to PBIL home page