(data stored in ACNUC7421 zone)

EMBL: CP000386.PE578

CP000386.PE578       Location/Qualifiers
FT   CDS             618375..618563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0587"
FT                   /product="YcfA-like protein"
FT                   /note="PFAM: YcfA-like; KEGG: rba:RB3259 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03559"
FT                   /db_xref="GOA:Q1AYG9"
FT                   /db_xref="InterPro:IPR012933"
FT                   /db_xref="InterPro:IPR038570"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYG9"
FT                   /protein_id="ABG03559.1"
FT                   /translation="MKRRQLLKHLAAHGVVLAREGANHSIYRDPRTGATVPVPRHAEIS
FT                   DALVRRICKEIGIPPPG"
     MKRRQLLKHL AAHGVVLARE GANHSIYRDP RTGATVPVPR HAEISDALVR RICKEIGIPP        60
     PG                                                                       62
//

If you have problems or comments...

PBIL Back to PBIL home page