(data stored in ACNUC7421 zone)

EMBL: CP000386.PE58

CP000386.PE58        Location/Qualifiers
FT   CDS             59615..60397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0058"
FT                   /product="biotin/lipoate A/B protein ligase"
FT                   /note="PFAM: biotin/lipoate A/B protein ligase; KEGG:
FT                   hma:rrnAC2235 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03039"
FT                   /db_xref="GOA:Q1AZY9"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZY9"
FT                   /protein_id="ABG03039.1"
FT                   /translation="MAVRRSSGVELLMPGRLPDAATAYGYARTVFEQVASGERPPTISL
FT                   APSVRHVGVTRRDTRREGFAAAVREAEGMGYPVLVRGAGGGAIAAGPGTFGFSIVRPRG
FT                   GESARGGFRERYEEAAALALGAFRRLGVRAEVGEVRDEFCPGDHSIRVGGWEEGMKLCG
FT                   IAQRVTRRAASVGGIVLVCGEEELARVLERVYAAMGLPFRPGSVGSLRRAGYGGGLEEA
FT                   LEAFAAEAEARYGARRVPLDGRTLGLARRAGPEHRAAL"
     MAVRRSSGVE LLMPGRLPDA ATAYGYARTV FEQVASGERP PTISLAPSVR HVGVTRRDTR        60
     REGFAAAVRE AEGMGYPVLV RGAGGGAIAA GPGTFGFSIV RPRGGESARG GFRERYEEAA       120
     ALALGAFRRL GVRAEVGEVR DEFCPGDHSI RVGGWEEGMK LCGIAQRVTR RAASVGGIVL       180
     VCGEEELARV LERVYAAMGL PFRPGSVGSL RRAGYGGGLE EALEAFAAEA EARYGARRVP       240
     LDGRTLGLAR RAGPEHRAAL                                                   260
//

If you have problems or comments...

PBIL Back to PBIL home page