(data stored in ACNUC7421 zone)

EMBL: CP000386.PE581

CP000386.PE581       Location/Qualifiers
FT   CDS             complement(620967..621626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0591"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_0640 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03562"
FT                   /db_xref="GOA:Q1AYG6"
FT                   /db_xref="InterPro:IPR021454"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYG6"
FT                   /protein_id="ABG03562.1"
FT                   /translation="MNGTTAPRRLRASISGGTKSYTAERFGALGRIRREPRGGGRMNAV
FT                   YLVAGGIVLALIVAFAVFAVLDSRRGGGEIAGVRSYDVGPGNRHTRGEVDYEQTPPAGG
FT                   VHSPVWQNCGFYEEPVRDENAVHSLEHGAVWITYRPDLPREQVERLRELARSQTYVLVS
FT                   PYPGLPAPVVASAWGKQLRLDSAEDGRLEQFVRAYRQGPQTPEPGAACTGGVGEPS"
     MNGTTAPRRL RASISGGTKS YTAERFGALG RIRREPRGGG RMNAVYLVAG GIVLALIVAF        60
     AVFAVLDSRR GGGEIAGVRS YDVGPGNRHT RGEVDYEQTP PAGGVHSPVW QNCGFYEEPV       120
     RDENAVHSLE HGAVWITYRP DLPREQVERL RELARSQTYV LVSPYPGLPA PVVASAWGKQ       180
     LRLDSAEDGR LEQFVRAYRQ GPQTPEPGAA CTGGVGEPS                              219
//

If you have problems or comments...

PBIL Back to PBIL home page