(data stored in ACNUC7421 zone)

EMBL: CP000386.PE585

CP000386.PE585       Location/Qualifiers
FT   CDS             complement(625238..625615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0595"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein, ArsR; KEGG: dra:DRA0071
FT                   transcriptional repressor SmtB"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03566"
FT                   /db_xref="GOA:Q1AYG2"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018334"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYG2"
FT                   /protein_id="ABG03566.1"
FT                   /translation="MGGETRQAENLSTCEETGIHPQQVSEALSGMPKPAEIRGASELLK
FT                   AVGDPTRMRILCALADRELCVCDLQAVLGLSQSAVSHQLRTLRNARLVTYRREGKMAYY
FT                   TLADDHVRRLLDLSLEHVRHA"
     MGGETRQAEN LSTCEETGIH PQQVSEALSG MPKPAEIRGA SELLKAVGDP TRMRILCALA        60
     DRELCVCDLQ AVLGLSQSAV SHQLRTLRNA RLVTYRREGK MAYYTLADDH VRRLLDLSLE       120
     HVRHA                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page