(data stored in ACNUC7421 zone)

EMBL: CP000386.PE586

CP000386.PE586       Location/Qualifiers
FT   CDS             complement(625625..626515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0596"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein; KEGG: mbo:Mb2050c
FT                   possible conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03567"
FT                   /db_xref="GOA:Q1AYG1"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYG1"
FT                   /protein_id="ABG03567.1"
FT                   /translation="MRDRDALEASEQGIRAVKLSFAVLALTAVLQLAVALVSGSAALLA
FT                   DTAHNFGDALTALPLWLAFALSRRPPSRTHTYGYGRAEDLAGAAIVGIILLSALVCGYE
FT                   SATKLLEGSGVRGAGWVALAAAAGFAGNELAARLRISVGRRIGSAALVADGQHARTDGL
FT                   TSLAVLAGAAGAWLGYPVVDPLVGLGITAAILHIVRDSARPVWRRLMDAVEPGTVEALE
FT                   EAASGMPEVLRVEEVRARWTGHSLQAEVRVRVEPDLPAGRLGDLSGRLAAAARKRLPRL
FT                   ERVLLEPVPDRPGDV"
     MRDRDALEAS EQGIRAVKLS FAVLALTAVL QLAVALVSGS AALLADTAHN FGDALTALPL        60
     WLAFALSRRP PSRTHTYGYG RAEDLAGAAI VGIILLSALV CGYESATKLL EGSGVRGAGW       120
     VALAAAAGFA GNELAARLRI SVGRRIGSAA LVADGQHART DGLTSLAVLA GAAGAWLGYP       180
     VVDPLVGLGI TAAILHIVRD SARPVWRRLM DAVEPGTVEA LEEAASGMPE VLRVEEVRAR       240
     WTGHSLQAEV RVRVEPDLPA GRLGDLSGRL AAAARKRLPR LERVLLEPVP DRPGDV           296
//

If you have problems or comments...

PBIL Back to PBIL home page