(data stored in ACNUC7421 zone)

EMBL: CP000386.PE587

CP000386.PE587       Location/Qualifiers
FT   CDS             complement(626512..626940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0597"
FT                   /product="protein of unknown function UPF0066"
FT                   /note="PFAM: protein of unknown function UPF0066; KEGG:
FT                   pab:PAB0452 virR related"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03568"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="InterPro:IPR036413"
FT                   /db_xref="InterPro:IPR036414"
FT                   /db_xref="InterPro:IPR040372"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYG0"
FT                   /protein_id="ABG03568.1"
FT                   /translation="MSGRVELSPIGYVRTRPGRVPRSWTTSGVEGVLEVLPEYAEGLRD
FT                   LREGERILVVFHFHQSPPFGPEHLRQTPPHREGPVGVFSTCSPLRPNPVGVSVLEVLGV
FT                   EGRCVRVRGLDMLDGTPVLDIKPHVAADPSHPCRRERA"
     MSGRVELSPI GYVRTRPGRV PRSWTTSGVE GVLEVLPEYA EGLRDLREGE RILVVFHFHQ        60
     SPPFGPEHLR QTPPHREGPV GVFSTCSPLR PNPVGVSVLE VLGVEGRCVR VRGLDMLDGT       120
     PVLDIKPHVA ADPSHPCRRE RA                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page