(data stored in ACNUC7421 zone)

EMBL: CP000386.PE593

CP000386.PE593       Location/Qualifiers
FT   CDS             complement(630050..630328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0603"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03574"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYF4"
FT                   /protein_id="ABG03574.1"
FT                   /translation="MGIRDFIRYLEEHRERLRSGEEIPAEERSEMLKQAEMMVGMAEAA
FT                   IKELDSVLRNRRINLPEEHAVRFAQDVFRHLRDEEEKVKRRLRALSP"
     MGIRDFIRYL EEHRERLRSG EEIPAEERSE MLKQAEMMVG MAEAAIKELD SVLRNRRINL        60
     PEEHAVRFAQ DVFRHLRDEE EKVKRRLRAL SP                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page