(data stored in ACNUC7421 zone)

EMBL: CP000386.PE60

CP000386.PE60        Location/Qualifiers
FT   CDS             61914..62852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0060"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: ATPase; KEGG:
FT                   gme:Gmet_0657 ABC transporter-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03041"
FT                   /db_xref="GOA:Q1AZY7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZY7"
FT                   /protein_id="ABG03041.1"
FT                   /translation="MIEAEGLGMSFGGEEVLGEIYLSVGEGEIFGLIGPSGAGKSTLTR
FT                   LLTGYLRPSRGSVRVFGRDPCAFGAADRRRIGFMPQGFVLYGGLSVRQNVNFAAGLYGL
FT                   RLGERRRRVREVLEFTELWKDRRKAASRLSGGMQRRLQLAAALVHEPQLLFVDEPTANL
FT                   DPILRRKFWEGFEVLRDMGRTIFVTTQYVGEAELCDRVGLLSGGGLAAVGTPEELRRRA
FT                   FGGEAMELTLAGEPGRLGRHLDALEGVGHVVEVREERPGDGAAASTVRLVVEDADTALP
FT                   RAFEALRGAEVLSADLIHPSFDEVFVRLVRG"
     MIEAEGLGMS FGGEEVLGEI YLSVGEGEIF GLIGPSGAGK STLTRLLTGY LRPSRGSVRV        60
     FGRDPCAFGA ADRRRIGFMP QGFVLYGGLS VRQNVNFAAG LYGLRLGERR RRVREVLEFT       120
     ELWKDRRKAA SRLSGGMQRR LQLAAALVHE PQLLFVDEPT ANLDPILRRK FWEGFEVLRD       180
     MGRTIFVTTQ YVGEAELCDR VGLLSGGGLA AVGTPEELRR RAFGGEAMEL TLAGEPGRLG       240
     RHLDALEGVG HVVEVREERP GDGAAASTVR LVVEDADTAL PRAFEALRGA EVLSADLIHP       300
     SFDEVFVRLV RG                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page