(data stored in ACNUC7421 zone)

EMBL: CP000386.PE65

CP000386.PE65        Location/Qualifiers
FT   CDS             67084..67470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0065"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; KEGG: bha:BH1164
FT                   transcriptional regulator (GntR family)"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03046"
FT                   /db_xref="GOA:Q1AZY2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZY2"
FT                   /protein_id="ABG03046.1"
FT                   /translation="MEDPEPMYRQIEGQLRKLILGGHLPPGTRLPPVRALAQDLSCSVI
FT                   TTRRAYQDLEAEGLVRTRQGLGTVVAEIGEEERARHRRSAVLAAFREAVESGLRAGCSP
FT                   GELYEIFEQAVRQQTKRRDEDEAV"
     MEDPEPMYRQ IEGQLRKLIL GGHLPPGTRL PPVRALAQDL SCSVITTRRA YQDLEAEGLV        60
     RTRQGLGTVV AEIGEEERAR HRRSAVLAAF REAVESGLRA GCSPGELYEI FEQAVRQQTK       120
     RRDEDEAV                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page