(data stored in ACNUC7421 zone)

EMBL: CP000386.PE67

CP000386.PE67        Location/Qualifiers
FT   CDS             complement(68373..69221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0067"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ret:RHE_PF00567 probable
FT                   sugar ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03048"
FT                   /db_xref="GOA:Q1AZY0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZY0"
FT                   /protein_id="ABG03048.1"
FT                   /translation="MLGSKARAERLTRAGLYAAYAAITAFFLFPIFWVVSMSLKTVPQL
FT                   FASPPVWFPVPPQFENYAYVLTGTSIGRYLLNSAFIVLMTVIFTLIIATLAAYGFSRFS
FT                   FRYKRPSLLAVLVFQMVSPVVIAIPLYRFFAALGLLNSYATLILVYVAIVLPFTTWFLK
FT                   GYFDTIPYEMDEAAIVDGASRWQVLTRILLPVCAPGIATAAILAAVLSWSQFVVPFILL
FT                   DSRELYPISVGLVDLKNTSDAITLHYLSAASVIAIAPVIAVFVLLQRYIVNALTAGAIK
FT                   G"
     MLGSKARAER LTRAGLYAAY AAITAFFLFP IFWVVSMSLK TVPQLFASPP VWFPVPPQFE        60
     NYAYVLTGTS IGRYLLNSAF IVLMTVIFTL IIATLAAYGF SRFSFRYKRP SLLAVLVFQM       120
     VSPVVIAIPL YRFFAALGLL NSYATLILVY VAIVLPFTTW FLKGYFDTIP YEMDEAAIVD       180
     GASRWQVLTR ILLPVCAPGI ATAAILAAVL SWSQFVVPFI LLDSRELYPI SVGLVDLKNT       240
     SDAITLHYLS AASVIAIAPV IAVFVLLQRY IVNALTAGAI KG                          282
//

If you have problems or comments...

PBIL Back to PBIL home page