(data stored in ACNUC7421 zone)

EMBL: CP000386.PE68

CP000386.PE68        Location/Qualifiers
FT   CDS             complement(69223..70143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0068"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ret:RHE_PF00566 putative
FT                   sugar ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03049"
FT                   /db_xref="GOA:Q1AZX9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZX9"
FT                   /protein_id="ABG03049.1"
FT                   /translation="MTAAKTRGPGGSWLESLAGSPWPWLLPLAAILLATFVFPIFEIVR
FT                   LSFTNASLVGGGHEYTLGSYASLLTSPYFLDMLTATAVFVFFSVLFQMLLGFLIALAVD
FT                   QGARRGMRASIVTRTAVLSAWAIPGVIIGIIWSILYQQSQVGVLNYLLGLVGVGPVPFL
FT                   SDPEFALASVTVANIWRGTAFSMILIYAGLQTLPDDVLEAARVDGANAWQSLTRVVIPL
FT                   LAPILFINLVIVSIETFNTFDMVLALTGGGPGRATEVIALSIYNQIFQQFDLGPGAATA
FT                   VLLLAVNAVMTVVYIRLLQREEEVA"
     MTAAKTRGPG GSWLESLAGS PWPWLLPLAA ILLATFVFPI FEIVRLSFTN ASLVGGGHEY        60
     TLGSYASLLT SPYFLDMLTA TAVFVFFSVL FQMLLGFLIA LAVDQGARRG MRASIVTRTA       120
     VLSAWAIPGV IIGIIWSILY QQSQVGVLNY LLGLVGVGPV PFLSDPEFAL ASVTVANIWR       180
     GTAFSMILIY AGLQTLPDDV LEAARVDGAN AWQSLTRVVI PLLAPILFIN LVIVSIETFN       240
     TFDMVLALTG GGPGRATEVI ALSIYNQIFQ QFDLGPGAAT AVLLLAVNAV MTVVYIRLLQ       300
     REEEVA                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page