(data stored in ACNUC7421 zone)

EMBL: CP000386.PE69

CP000386.PE69        Location/Qualifiers
FT   CDS             complement(70158..71456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0069"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /note="TIGRFAM: Twin-arginine translocation pathway signal;
FT                   PFAM: extracellular solute-binding protein, family 1; KEGG:
FT                   ret:RHE_PF00565 putative sugar ABC transporter,
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03050"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZX8"
FT                   /protein_id="ABG03050.1"
FT                   /translation="MMQTRLSRREFLRLGGASLAGAALLGAAGCGGGGGGENAIGWQAI
FT                   PSYSTEQNTDQARVEYLEQAISEWEEQNGEYTINPLVTSADVTAAMARLLEQASQDRAP
FT                   DIAQIDGYILPRFYDYVRPLDDYLGDLSLEDWFPFARAVMTDGGSVKGLQFTTDVRVLY
FT                   YRKDLIDSPPASWDELFSAGQRVSGEVQDAFLFPAGRGEATTITTLLPQFWTLGGELVD
FT                   DRGEPVFGEGENRRAMLEALGFIRECVERGITPRRVTEFTLETDINGDAASGQTAMFLG
FT                   GNWQVSLLKEIMGEERFTRQWGVAPIPSHSGEEHATTAGGWAWGVFAENEDKRRAAVDF
FT                   LRAVFVGNQGMARWCNVGGYLPPREPVFEVPAYETDEYTDTFREHLENFARNRPSAESY
FT                   TDISTALQVAVTQVVSGEASPEQALRTAVRTVG"
     MMQTRLSRRE FLRLGGASLA GAALLGAAGC GGGGGGENAI GWQAIPSYST EQNTDQARVE        60
     YLEQAISEWE EQNGEYTINP LVTSADVTAA MARLLEQASQ DRAPDIAQID GYILPRFYDY       120
     VRPLDDYLGD LSLEDWFPFA RAVMTDGGSV KGLQFTTDVR VLYYRKDLID SPPASWDELF       180
     SAGQRVSGEV QDAFLFPAGR GEATTITTLL PQFWTLGGEL VDDRGEPVFG EGENRRAMLE       240
     ALGFIRECVE RGITPRRVTE FTLETDINGD AASGQTAMFL GGNWQVSLLK EIMGEERFTR       300
     QWGVAPIPSH SGEEHATTAG GWAWGVFAEN EDKRRAAVDF LRAVFVGNQG MARWCNVGGY       360
     LPPREPVFEV PAYETDEYTD TFREHLENFA RNRPSAESYT DISTALQVAV TQVVSGEASP       420
     EQALRTAVRT VG                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page