(data stored in ACNUC7421 zone)

EMBL: CP000386.PE81

CP000386.PE81        Location/Qualifiers
FT   CDS             84572..86173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0081"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH periplasmic
FT                   binding protein/LacI transcriptional regulator; KEGG:
FT                   mta:Moth_2024 transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03062"
FT                   /db_xref="GOA:Q1AZW6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZW6"
FT                   /protein_id="ABG03062.1"
FT                   /translation="MRQDLLARIRRGEFPPGSLLPSESQICEQYGVSVTTARRAFLELV
FT                   KEGVVRRRAGVGTMVAPRVRRARIAFASIDYTGDAWRHIPSVIGEMFAGIGEHAWRRDA
FT                   VLEIVGVEDEEAEGYLRRVAERRPVDGLLLRVANDIRGEHLDILERAGMPYVLIKRHIP
FT                   GRRMNCVISDDVTGARMATSHLLELGHRRIGFVCGKPHLTLNRERLAGYREALEEHGVG
FT                   FDEGLVRQEEHFTTEMGYRAVRSLLEAPSRPSAVFVASDTMAIGGYEAVWDLGLRIPDD
FT                   VSIVGYDDIQAASALQPPLTTVRTSYYDFGRLAAQLLLDLIEGREVAPQRRVIHPTLVV
FT                   RGSTRRLSPGRGARHRPPREPAPVPSPGRLSGLGLLCSGLDAALRQEVVRACAAEGALP
FT                   LAGEEAPPDVWVQGLSLWQDLGTNLRRALERGRMALRRIKEGGSLVYVASAMSPDPSLG
FT                   GIEHEAVRAGLERVVRVLAGEGAGRGVRVNALLCLADRHELQTERAAQVAGTVAFLASP
FT                   AARGISGETLALDGPP"
     MRQDLLARIR RGEFPPGSLL PSESQICEQY GVSVTTARRA FLELVKEGVV RRRAGVGTMV        60
     APRVRRARIA FASIDYTGDA WRHIPSVIGE MFAGIGEHAW RRDAVLEIVG VEDEEAEGYL       120
     RRVAERRPVD GLLLRVANDI RGEHLDILER AGMPYVLIKR HIPGRRMNCV ISDDVTGARM       180
     ATSHLLELGH RRIGFVCGKP HLTLNRERLA GYREALEEHG VGFDEGLVRQ EEHFTTEMGY       240
     RAVRSLLEAP SRPSAVFVAS DTMAIGGYEA VWDLGLRIPD DVSIVGYDDI QAASALQPPL       300
     TTVRTSYYDF GRLAAQLLLD LIEGREVAPQ RRVIHPTLVV RGSTRRLSPG RGARHRPPRE       360
     PAPVPSPGRL SGLGLLCSGL DAALRQEVVR ACAAEGALPL AGEEAPPDVW VQGLSLWQDL       420
     GTNLRRALER GRMALRRIKE GGSLVYVASA MSPDPSLGGI EHEAVRAGLE RVVRVLAGEG       480
     AGRGVRVNAL LCLADRHELQ TERAAQVAGT VAFLASPAAR GISGETLALD GPP              533
//

If you have problems or comments...

PBIL Back to PBIL home page