(data stored in ACNUC7421 zone)

EMBL: CP000386.PE86

CP000386.PE86        Location/Qualifiers
FT   CDS             89704..90321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0086"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ehi:42.t00003 hypothetical protein PROSITE:
FT                   ARG_RICH GLU_RICH LYS_RICH PRO_RICH SER_RICH THR_RICH"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03067"
FT                   /db_xref="InterPro:IPR005607"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZW1"
FT                   /protein_id="ABG03067.1"
FT                   /translation="MDPREERIGLYGAAAILDVGAEEVVRLAERGELRSERDEGGVYSF
FT                   SLADVLELARERSAREAEEEIFEGEVIGEEERSSRLPAVPFERYERLLQQGQDFKTRLE
FT                   ERTRQMEEIRQERDAARLEIDRLWEEIERLRLSEFQRELQEKTISTLEEEKKRLEEERE
FT                   RLIEERMKLLEEKSQLAEERTRLEAEIKVLKNRSFWSRLFGG"
     MDPREERIGL YGAAAILDVG AEEVVRLAER GELRSERDEG GVYSFSLADV LELARERSAR        60
     EAEEEIFEGE VIGEEERSSR LPAVPFERYE RLLQQGQDFK TRLEERTRQM EEIRQERDAA       120
     RLEIDRLWEE IERLRLSEFQ RELQEKTIST LEEEKKRLEE ERERLIEERM KLLEEKSQLA       180
     EERTRLEAEI KVLKNRSFWS RLFGG                                             205
//

If you have problems or comments...

PBIL Back to PBIL home page