(data stored in ACNUC7421 zone)

EMBL: CP000386.PE9

CP000386.PE9         Location/Qualifiers
FT   CDS             10952..11329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0009"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABG02990"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B038"
FT                   /protein_id="ABG02990.1"
FT                   /translation="MGINQRVSLRKFRDDIERWVEEGRSDEWIASALGTSASSVQSFRS
FT                   RNGIYRRSAAPALRDPEDYAAYEGVVERGERIGLWFDPQVQDDPRWKEGWSGAERVEIR
FT                   LTPRKIVLRRRPGASGSGSKV"
     MGINQRVSLR KFRDDIERWV EEGRSDEWIA SALGTSASSV QSFRSRNGIY RRSAAPALRD        60
     PEDYAAYEGV VERGERIGLW FDPQVQDDPR WKEGWSGAER VEIRLTPRKI VLRRRPGASG       120
     SGSKV                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page