(data stored in ACNUC7421 zone)

EMBL: CP000386.PE97

CP000386.PE97        Location/Qualifiers
FT   CDS             complement(102028..103296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0098"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /note="KEGG: deh:cbdb_A1731 aspartate kinase,
FT                   monofunctional class; TIGRFAM: aspartate kinase aspartate
FT                   kinase, monofunctional class; PFAM:
FT                   aspartate/glutamate/uridylate kinase amino acid-binding
FT                   ACT"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03078"
FT                   /db_xref="GOA:Q1AZV0"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZV0"
FT                   /protein_id="ABG03078.1"
FT                   /translation="MERRHRQRERPLGIVVQKYGGSSVATAEHIKAVAGKIQRARKAGL
FT                   DLVVVASAMGKTTDRLLRLAGEVSSDPSPREIDQLLATGEEQSVALLAMALHDRGVPAV
FT                   SLTGPQAGMRATGRYGSGVISEIRPGRIRRLLGEGRVVIVAGFQGMNALGDVMTLGRGG
FT                   SDTTAVALAAALGADRCEIYTDVDGVYTADPRIVPGARRIPVISYAEMSEMAWRGAKVM
FT                   HPRAVELGALYGVEIHVLSSFDEESPGTIITGGEKVEHLETRETVAGIVHDTDVARITL
FT                   NGVRTGPGTLSKVFTPLAERGISVDVIVESGIKEGVADIAFTVSRADFAEARSAAGEVA
FT                   RALGGSVEGEEGLAKVSVVGTGMLNRPGYAARMFSALGSEGIPIRMVSTSEIQVTCVIP
FT                   AERVQEAVRRLHRDFELEEREDV"
     MERRHRQRER PLGIVVQKYG GSSVATAEHI KAVAGKIQRA RKAGLDLVVV ASAMGKTTDR        60
     LLRLAGEVSS DPSPREIDQL LATGEEQSVA LLAMALHDRG VPAVSLTGPQ AGMRATGRYG       120
     SGVISEIRPG RIRRLLGEGR VVIVAGFQGM NALGDVMTLG RGGSDTTAVA LAAALGADRC       180
     EIYTDVDGVY TADPRIVPGA RRIPVISYAE MSEMAWRGAK VMHPRAVELG ALYGVEIHVL       240
     SSFDEESPGT IITGGEKVEH LETRETVAGI VHDTDVARIT LNGVRTGPGT LSKVFTPLAE       300
     RGISVDVIVE SGIKEGVADI AFTVSRADFA EARSAAGEVA RALGGSVEGE EGLAKVSVVG       360
     TGMLNRPGYA ARMFSALGSE GIPIRMVSTS EIQVTCVIPA ERVQEAVRRL HRDFELEERE       420
     DV                                                                      422
//

If you have problems or comments...

PBIL Back to PBIL home page