(data stored in ACNUC7421 zone)

EMBL: CP000386.PE98

CP000386.PE98        Location/Qualifiers
FT   CDS             complement(103337..103846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0099"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sco:SCO6430 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03079"
FT                   /db_xref="GOA:Q1AZU9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZU9"
FT                   /protein_id="ABG03079.1"
FT                   /translation="MFLSVYVLYLTRDLGLGPGAVGLVFALGGVGALPGALAAGPAVRV
FT                   LGRGPMIAVSAVLCGFFGFAIPLAVLFPEIALPMVLAAEFFQWLFLAAYRVGEASLRQE
FT                   ITPDHILGRVNATQRFMVYGAIPLGGLLGGILGELAGVPLTLVVGMAGTLLASLWTLLP
FT                   PVRGVR"
     MFLSVYVLYL TRDLGLGPGA VGLVFALGGV GALPGALAAG PAVRVLGRGP MIAVSAVLCG        60
     FFGFAIPLAV LFPEIALPMV LAAEFFQWLF LAAYRVGEAS LRQEITPDHI LGRVNATQRF       120
     MVYGAIPLGG LLGGILGELA GVPLTLVVGM AGTLLASLWT LLPPVRGVR                   169
//

If you have problems or comments...

PBIL Back to PBIL home page