(data stored in SCRATCH zone)

EMBL: CP000423.PE101

CP000423.PE101       Location/Qualifiers
FT   CDS             96713..97090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0103"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ68967"
FT                   /db_xref="UniProtKB/TrEMBL:Q03CV5"
FT                   /protein_id="ABJ68967.1"
FT                   /translation="MKKHRFVIALVGLSLFAASSTIAADMTQANMDQHSVTYTIKGDGL
FT                   VIFDKTRTYRTKSTAAAYKGTFAADAPTASFEKVGTLANHKDYRVTRKIKVKAKMQGAA
FT                   AQTFFYVNGHGWVKGSDLTRE"
     MKKHRFVIAL VGLSLFAASS TIAADMTQAN MDQHSVTYTI KGDGLVIFDK TRTYRTKSTA        60
     AAYKGTFAAD APTASFEKVG TLANHKDYRV TRKIKVKAKM QGAAAQTFFY VNGHGWVKGS       120
     DLTRE                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page