(data stored in SCRATCH zone)

EMBL: CP000423.PE105

CP000423.PE105       Location/Qualifiers
FT   CDS             101336..101923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0107"
FT                   /product="Phospholipase A2 family enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ68971"
FT                   /db_xref="GOA:Q03CV1"
FT                   /db_xref="InterPro:IPR016090"
FT                   /db_xref="InterPro:IPR036444"
FT                   /db_xref="UniProtKB/TrEMBL:Q03CV1"
FT                   /protein_id="ABJ68971.1"
FT                   /translation="MKFSKRSKRFDIIRRSAVIVFALISMTLFFQFNSGVEVHATTKTE
FT                   FNDTEINRETSEQLKMIDPYLKNVDGITSFDYDAAMNDNVDPVVLKIGAEINKWARSLK
FT                   NDGPEKGMLFSMARFNLLVYGNYCGKGNNGKAPIDDLDGACQAHDTCYAWGGNNEKCNQ
FT                   EFRQRLLTIMQETSLFDYKHIVAVAAYKLFGG"
     MKFSKRSKRF DIIRRSAVIV FALISMTLFF QFNSGVEVHA TTKTEFNDTE INRETSEQLK        60
     MIDPYLKNVD GITSFDYDAA MNDNVDPVVL KIGAEINKWA RSLKNDGPEK GMLFSMARFN       120
     LLVYGNYCGK GNNGKAPIDD LDGACQAHDT CYAWGGNNEK CNQEFRQRLL TIMQETSLFD       180
     YKHIVAVAAY KLFGG                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page