(data stored in SCRATCH zone)

EMBL: CP000423.PE111

CP000423.PE111       Location/Qualifiers
FT   CDS             complement(105967..106494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0113"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ68977"
FT                   /db_xref="GOA:Q03CU5"
FT                   /db_xref="UniProtKB/TrEMBL:Q03CU5"
FT                   /protein_id="ABJ68977.1"
FT                   /translation="MLTIMHQDILTLLKNKPIMIYLVLYPPLLILVTGFVFSGIFSDDV
FT                   LTSYDYYGVTMMIYLSMATVIILPEMLFGSHVKYANYRIIYAPIARAKVYLSKLLVSIG
FT                   FAYIIMAAYMLLFNTIGLVDFGGKNIGGLLLLDLVFVIFAITFGGAFCVIIRNEDLSTN
FT                   LLNLLINVFAIA"
     MLTIMHQDIL TLLKNKPIMI YLVLYPPLLI LVTGFVFSGI FSDDVLTSYD YYGVTMMIYL        60
     SMATVIILPE MLFGSHVKYA NYRIIYAPIA RAKVYLSKLL VSIGFAYIIM AAYMLLFNTI       120
     GLVDFGGKNI GGLLLLDLVF VIFAITFGGA FCVIIRNEDL STNLLNLLIN VFAIA            175
//

If you have problems or comments...

PBIL Back to PBIL home page