(data stored in SCRATCH zone)

EMBL: CP000423.PE113

CP000423.PE113       Location/Qualifiers
FT   CDS             107812..109818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0115"
FT                   /product="Signaling protein (consists of PAS, a modified
FT                   GGDEF and a DHH family phosphatase domains)"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ68979"
FT                   /db_xref="GOA:Q03CU3"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR014528"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:Q03CU3"
FT                   /protein_id="ABJ68979.1"
FT                   /translation="MKKLFERIRMPEFLEDMRMRYAAIAMVVLAVIGILMGALIRPWLA
FT                   LLMLLILISLVATIFYALETIAKNTNQYISDLSYRIKRGEQEALIKMPIGILIYDENLN
FT                   IEWTNPFLQKYFGDTDVLGQPLEHVDAELAELIRSNENTNETKMVTWGQHQFEIIVQKS
FT                   IGVVYLMDVTRYAEIEERAEDEKIAIGQIFIDNYDEITQTMDDQVITNLNSYVTNQLTD
FT                   WANQFGMFLKRIDNDRFFLLAYAKSLKDVERDKFKILDVIPEETSKQNYPLTLSLGIAY
FT                   GDEDLAQLAVTSQSNLDLALGRGGDQVVVRAKGHEARFYGGKTNPMEKRTRVRARMVAQ
FT                   ALQELFKQTDKVFVVGHKRPDMDAVGASMGIRRIAQMNGKECYIVIDPDHLHSDVERLM
FT                   GQVGQDPEVANAIVTPEAALSQATDQSLLILVDHSKPSISAAPDLYKRLAARTVIIDHH
FT                   RRGEEFPDNPMLVYIEPYASSTCELIAEMFEYQPTNVPSLDKLEATAMLAGITVDTKSF
FT                   SLRTGTRTFDAASYLRSMGADGMLAQNLLKENIDSFIQRNHLIDTIEMIAPNMALCTGE
FT                   EDKRYDPVIAAQAADTMLSLNGVDASFVITKRPSGDVGISARSTGDVNVQVIMEAMGGG
FT                   GHLSNAATQIKGKTIAEVRTDLLAQIKKADEDA"
     MKKLFERIRM PEFLEDMRMR YAAIAMVVLA VIGILMGALI RPWLALLMLL ILISLVATIF        60
     YALETIAKNT NQYISDLSYR IKRGEQEALI KMPIGILIYD ENLNIEWTNP FLQKYFGDTD       120
     VLGQPLEHVD AELAELIRSN ENTNETKMVT WGQHQFEIIV QKSIGVVYLM DVTRYAEIEE       180
     RAEDEKIAIG QIFIDNYDEI TQTMDDQVIT NLNSYVTNQL TDWANQFGMF LKRIDNDRFF       240
     LLAYAKSLKD VERDKFKILD VIPEETSKQN YPLTLSLGIA YGDEDLAQLA VTSQSNLDLA       300
     LGRGGDQVVV RAKGHEARFY GGKTNPMEKR TRVRARMVAQ ALQELFKQTD KVFVVGHKRP       360
     DMDAVGASMG IRRIAQMNGK ECYIVIDPDH LHSDVERLMG QVGQDPEVAN AIVTPEAALS       420
     QATDQSLLIL VDHSKPSISA APDLYKRLAA RTVIIDHHRR GEEFPDNPML VYIEPYASST       480
     CELIAEMFEY QPTNVPSLDK LEATAMLAGI TVDTKSFSLR TGTRTFDAAS YLRSMGADGM       540
     LAQNLLKENI DSFIQRNHLI DTIEMIAPNM ALCTGEEDKR YDPVIAAQAA DTMLSLNGVD       600
     ASFVITKRPS GDVGISARST GDVNVQVIME AMGGGGHLSN AATQIKGKTI AEVRTDLLAQ       660
     IKKADEDA                                                                668
//

If you have problems or comments...

PBIL Back to PBIL home page