(data stored in SCRATCH zone)

EMBL: CP000423.PE131

CP000423.PE131       Location/Qualifiers
FT   CDS             132902..134251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0133"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ68997"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="UniProtKB/TrEMBL:Q03CS5"
FT                   /protein_id="ABJ68997.1"
FT                   /translation="MTLDMNVMAFWQNKLKAIGPRLTATDSHAKFIELLQDEIKNLGFN
FT                   TIEFPFKINRCLQSSCSLENDSTKEKIPNLGPVPYSGITKEMGVKGEIRFFQSKHDVKM
FT                   KGKVVVIKVKNFTIPKLLLMHQVAKYPRHTHIGFSIRHPLVAATLTLGKIQAAKDNGAV
FT                   GVILVWEHISEDLANREVLPFTNSYLGIPSVWVYQTQLEALKRCRDRKEPVRLTLTGQY
FT                   ETNVTTKSFAVLVPGENRSKQILINTHTDGPNDIEENGAIALLTVLHAIKHDNLKFKNT
FT                   LVFGFVSGHFQIPQSGIEGRQATSRFLRDLSMYETSQHLEMKKALGLTVEHLGGLDYVD
FT                   SQKENKLIATGLYDPLYVYASTKENRDLVLKSLSGTNASGRYQILKPRKNAYFGEGQPL
FT                   YQDGWPTISFIGMPLALCQMASPTTEPDIKSMFDQTKLIFQILVASDHQF"
     MTLDMNVMAF WQNKLKAIGP RLTATDSHAK FIELLQDEIK NLGFNTIEFP FKINRCLQSS        60
     CSLENDSTKE KIPNLGPVPY SGITKEMGVK GEIRFFQSKH DVKMKGKVVV IKVKNFTIPK       120
     LLLMHQVAKY PRHTHIGFSI RHPLVAATLT LGKIQAAKDN GAVGVILVWE HISEDLANRE       180
     VLPFTNSYLG IPSVWVYQTQ LEALKRCRDR KEPVRLTLTG QYETNVTTKS FAVLVPGENR       240
     SKQILINTHT DGPNDIEENG AIALLTVLHA IKHDNLKFKN TLVFGFVSGH FQIPQSGIEG       300
     RQATSRFLRD LSMYETSQHL EMKKALGLTV EHLGGLDYVD SQKENKLIAT GLYDPLYVYA       360
     STKENRDLVL KSLSGTNASG RYQILKPRKN AYFGEGQPLY QDGWPTISFI GMPLALCQMA       420
     SPTTEPDIKS MFDQTKLIFQ ILVASDHQF                                         449
//

If you have problems or comments...

PBIL Back to PBIL home page