(data stored in SCRATCH zone)

EMBL: CP000423.PE156

CP000423.PE156       Location/Qualifiers
FT   CDS             156975..157748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0158"
FT                   /product="cell surface protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69022"
FT                   /db_xref="InterPro:IPR027994"
FT                   /db_xref="UniProtKB/TrEMBL:Q03CQ0"
FT                   /protein_id="ABJ69022.1"
FT                   /translation="MKKSYLVASLAGLTLIGLSSMPVSMVGATTEVVSDGQVMFKTDVT
FT                   RTPAKNPLDPGDTKPGKPTNPTNPTGTATNGTTGPLSLDYASSFTFGEAMISADDAKYY
FT                   AKPQVFSQDDGKTVDRPNFVQVTDKRGTFEGWTLKVKQEKQFSVKDDDTKELTGAQLKF
FT                   LNGNVTSTIDQQYAPTGQKEITLVPGSAEVAPLAAAKDQGMGTWIYRFGDEQTMAKSIE
FT                   LAVPGTSPKMAKEYVTELTWTLESTPTNTTPSPKS"
     MKKSYLVASL AGLTLIGLSS MPVSMVGATT EVVSDGQVMF KTDVTRTPAK NPLDPGDTKP        60
     GKPTNPTNPT GTATNGTTGP LSLDYASSFT FGEAMISADD AKYYAKPQVF SQDDGKTVDR       120
     PNFVQVTDKR GTFEGWTLKV KQEKQFSVKD DDTKELTGAQ LKFLNGNVTS TIDQQYAPTG       180
     QKEITLVPGS AEVAPLAAAK DQGMGTWIYR FGDEQTMAKS IELAVPGTSP KMAKEYVTEL       240
     TWTLESTPTN TTPSPKS                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page