(data stored in SCRATCH zone)

EMBL: CP000423.PE160

CP000423.PE160       Location/Qualifiers
FT   CDS             160302..161762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0162"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69026"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q03CP6"
FT                   /protein_id="ABJ69026.1"
FT                   /translation="MKLLELMEKNDQKKLKLLYYLDQHPNRKLKNSELQDKLQISYYLF
FT                   KRQTKEIAEDIAAFDLSDFFAIEVTNTTVILHEYHNTNASVFLEHYLKQSLQIKILMTL
FT                   MHEPPAFNLTEFAEEHFGSYAFMYKRYTALRDTLKSWGIVLSNDGKLTGDELAIRLLLT
FT                   KIMVVAHIDETGFDDNVCSTLHELLQLLKMTEATPSMSQLIETKAYFLISLVRFQQGHV
FT                   IATSPEIVDLVRNIRERTLETRKRVIAIYQAHFTASDQTIDSECDYFGTFLAIIGIITS
FT                   EEIVFPDTIKQHGRAFIQGFEANFDVQLTLSEKANIEYVVNKCLIDVLALPFRSEFFDD
FT                   HIEVSYFFRMYPEFFDYCQQFVQARSVKLDRNQSKFMFYHCLLTLAANVPLNKVLEPLY
FT                   VCVDFTLGKEYNTIIERDIKYFSTLNVKVTNEVRPETKLIITDLVNAYHDTDISKVIWL
FT                   SPPRPEDWENVIEELLDLRLADRTVKKS"
     MKLLELMEKN DQKKLKLLYY LDQHPNRKLK NSELQDKLQI SYYLFKRQTK EIAEDIAAFD        60
     LSDFFAIEVT NTTVILHEYH NTNASVFLEH YLKQSLQIKI LMTLMHEPPA FNLTEFAEEH       120
     FGSYAFMYKR YTALRDTLKS WGIVLSNDGK LTGDELAIRL LLTKIMVVAH IDETGFDDNV       180
     CSTLHELLQL LKMTEATPSM SQLIETKAYF LISLVRFQQG HVIATSPEIV DLVRNIRERT       240
     LETRKRVIAI YQAHFTASDQ TIDSECDYFG TFLAIIGIIT SEEIVFPDTI KQHGRAFIQG       300
     FEANFDVQLT LSEKANIEYV VNKCLIDVLA LPFRSEFFDD HIEVSYFFRM YPEFFDYCQQ       360
     FVQARSVKLD RNQSKFMFYH CLLTLAANVP LNKVLEPLYV CVDFTLGKEY NTIIERDIKY       420
     FSTLNVKVTN EVRPETKLII TDLVNAYHDT DISKVIWLSP PRPEDWENVI EELLDLRLAD       480
     RTVKKS                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page