(data stored in SCRATCH zone)

EMBL: CP000423.PE162

CP000423.PE162       Location/Qualifiers
FT   CDS             complement(162962..163291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0164"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69028"
FT                   /db_xref="UniProtKB/TrEMBL:Q03CP4"
FT                   /protein_id="ABJ69028.1"
FT                   /translation="MTQMPSSLQGFPKGEFAAFSTAKMTHFLPYSQETSTDDLKGFFGA
FT                   NYQYLTKTPIGRLKIDIPNTEQLIVQYGEIIARFTNGKFKIIDSTYFHKNFNDPLVDED
FT                   EKGIY"
     MTQMPSSLQG FPKGEFAAFS TAKMTHFLPY SQETSTDDLK GFFGANYQYL TKTPIGRLKI        60
     DIPNTEQLIV QYGEIIARFT NGKFKIIDST YFHKNFNDPL VDEDEKGIY                   109
//

If you have problems or comments...

PBIL Back to PBIL home page